PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vang0613s00040.1
Common NameLR48_Vigan08g000200
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family MYB_related
Protein Properties Length: 195aa    MW: 22351.3 Da    PI: 6.9468
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vang0613s00040.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding49.41.1e-152168148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      +g W+++Ede+l+++    G g+W+ Iar  g+ R++k+c++rw +yl
  Vang0613s00040.1 21 KGLWSPDEDEKLIRYMLTNGQGCWSDIARNAGLQRCGKSCRLRWINYL 68
                      678*******************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129422.2021672IPR017930Myb domain
Gene3DG3DSA:1.10.10.607.4E-211967IPR009057Homeodomain-like
SMARTSM007175.8E-122070IPR001005SANT/Myb domain
PfamPF002492.5E-142168IPR001005SANT/Myb domain
SuperFamilySSF466894.27E-182391IPR009057Homeodomain-like
CDDcd001677.26E-112468No hitNo description
Gene3DG3DSA:1.10.10.609.6E-56892IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 195 aa     Download sequence    Send to blast
MRKPDLMANK DRMKDIIKLR KGLWSPDEDE KLIRYMLTNG QGCWSDIARN AGLQRCGKSC  60
RLRWINYLRP DLKRGAFSSQ EQHLIFHLHS IFEIFTCMED GHQVNHGTLE ANNKMGLGRD  120
FSLPSLESRS IESDSVPIDV KSHNNHFNYG SFNNTDNIQG SKLEDLIGFA NHGQGELYLE  180
NLMQNITSFP FLDF*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150391e-165AP015039.1 Vigna angularis var. angularis DNA, chromosome 6, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014493577.11e-60PREDICTED: transcription factor MYB46-like
TrEMBLA0A0L9V2253e-67A0A0L9V225_PHAAN; Uncharacterized protein
STRINGGLYMA12G36630.15e-52(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF77434128
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G08500.19e-49myb domain protein 83
Publications ? help Back to Top
  1. Yang K, et al.
    Genome sequencing of adzuki bean (Vigna angularis) provides insight into high starch and low fat accumulation and domestication.
    Proc. Natl. Acad. Sci. U.S.A., 2015. 112(43): p. 13213-8
    [PMID:26460024]